(WO2020/086885) WHAT IS CLAIMED: 1. A glycopeptide comprising one or more modified amino acid residues having a sidechain comprising an oligosaccharide, wherein the glycopeptide binds specifically to carbohydrate-binding monoclonal antibody PGT128, PGT130, or germline PGT128 with an affinity of less than 100 nM. 2. The glycopeptide according to claim 1, wherein the glycopeptide comprises L amino acids. 3. The glycopeptide according to claim 1, wherein the glycopeptide comprises D amino acids. 4. The glycopeptide according to claim 1, wherein the glycopeptide comprises a mixture of L and D amino acids. 5. The glycopeptide according to any one of claims 1 to 4, wherein the glycopeptide comprises about 10 to about 80 amino acids. 6. The glycopeptide according to any one of claims 1 to 4, wherein the glycopeptide comprises from 1 to about 10 of said modified amino acid residues. 7. The glycopeptide according to claim 6, wherein the glycopeptide comprises from 2 to 5 of said modified amino acid residues. 8. The glycopeptide according to claim 6, wherein two or more of said amino acid residues are at nonadjacent positions in the glycopeptide. 9. The glycopeptide according to claim 6, wherein two or more of said amino acid residues are at adjacent positions in the glycopeptide. 10. The glycopeptide according to any one of claims 1 to 4, wherein the glycopeptide contains one of said modified amino acid residues. 11. The glycopeptide according to any one of claims 1 to 10, wherein the oligosaccharide is a branched oligosaccharide. 12. The glycopeptide according to claim 11, wherein the branched oligosaccharide consists of 9 mannose moieties and 2 N-Acetylglucosamine moieties. 13. The glycopeptide according to any one of claims 1 to 12, wherein modified amino acid comprises a linker molecule between the polypeptide chain and the monosaccharide or N - N oligosaccharide, the linker molecule comprisingor wherein each of Ri and R2 is optionally a direct link or independently selected from the group consisting of a linear or branched Ci to Cl8 hydrocarbon that is saturated or mono- or poly-unsaturated, optionally interrupted by one or more non-adjacent -0-, -C(=0)-, or -NR4-; a substituted or unsubstituted C3 to Cl0 cycloalkanediyl, a substituted or unsubstituted aryl diradical; a substituted or unsubstituted heteroaryl diradical; a monosaccharide diradical; or a disaccharide diradical; R3 is optional and can be -0-, -S-, or -NR4-; and Rt is H or a Ci to Cl0 alkyl. 14. The glycopeptide according to any one of claims 1 to 13, wherein the glycopeptide binds specifically to monoclonal antibody PGT128 with an affinity of less than 50 nM. 15. The glycopeptide according to any one of claims 1 to 13, wherein the glycopeptide binds specifically to monoclonal antibody PGT128 with an affinity of less than 10 nM. 16. The glycopeptide according to claim 1, wherein the monoclonal antibody PGT128 binds specifically to Man9GlcNAc2 glycans on HIV gpl20 with an affinity comparable to the affinity of PGT128 binding to said glycopeptide. 17. The glycopeptide according to claim 1, wherein the glycopeptide binds specifically to PGT128 and comprises the sequence IGDIR (SEQ ID NO: 1) or IGDIRxA (SEQ ID NO:2), and a modified amino acid residue to which the oligosaccharide is linked. 18. The glycopeptide according to claim 17, wherein said glycopeptide comprises the sequence: Sequence _ SEQ ID NO: MAYFVHKKSRLLTNKAVKKRLHGCFQNQRSTIGDIRYAKCXRVSSNFFRRGS 8 VSLGHHHHHHRL MASHINSNPNQLLLLYLKSTIGDIRCAXCXDFRHYRNTKYVFXTRHNRRTGY 9 GSLGHHHHHHRL MASYYIHDIAVSAYSKRRGYHNIQVESLYPKIGDIRSAKCXTWRNHRHTXGS 10 GSLGHHHHHHRL MAHYSXNHXRHPLYPSVNHRXSYPRIGLLSRIGDIRSASCXLRCFRXRSTGS 11 GSLGHHHHHHRL MAHNLRTXRNKNLIXLAFLHAPILKSRRLVHIGDIRVAACTHXVDVAPXYGS 12 GSLGHHHHHHRL XYPNTLNNVYQKCNKYNVIGDIRXARCXHXEHFSSQDQPKSKHKRRYKGFGS 13 LGHHHHHHRL MALIHSRQLVYSKNYXCCLDIGDIRHVLRGKYNDHLFGNAIYRKGVKAFNGS 14 GSLGHHHHHHRL MADNEFKILXIAXLHKSKHRTYLDYLNLVWXIGDIRAFQXXLKTVLXEAKGS 15 GSLGHHHHHHRL MAFHHXPHFTXRLPLLRRNCIGDIRRLYSPLPRDPHANFKFSFVEPNANRGS 16 GSLGHHHHHHGYR MATDHNHSHRRPRREHLDXNXHYSRPXVANXIGDIRTFRRRYIQVXYHLXGS 17 DSLGHHHHHHRL MAHXS I PHHRKS IDDSLRHLIGDIRYRNRYLXRILYRTSHYKNYYCQHS IGS 18 GSLGHHHHHHRL MANLXXYKXWNXTLFQWXATHRYSHFHNKCIGDIRTTXSWTRSXXXHAXGS 19 GSLGHHHHHHRL MATFSRYHTIGDIRHHTLKHHQSKGLQXRLI FLKRQFKAXGNCLRWKILFGS 20 CSLGHHHHHHRL MALNSNSCHXRVATPISSWKIGDIRARFVSYLHYTNFSFSXXKXKFFTKXGS 21 GSLGHHHHHHRL MANVFPQTDRSLERSQCLFEAFHS IVXHXES IGDIRLECLRITIVALRTTGS 22 GSLGHHHHHHRL MAIPNGYRAFNRADXLLLTRIGDIRNAHCXARCNYIYELRPLHHYRWSNRGS 23 GSLGHHHHHHRL MANTFSYHQKLKXGRHTDEILHTHXXHKKXXIGDIRYATCXKCVIKSHFXGS 24 GSLGHHHHHHRL MAIHKHLHIHNKKFSTFKS I IGDIRLAWCXNEYNIXPRCNSPRRFSYTAFGS 25 GSLGHHHHHHRL MAFKTNHTRCDHNSQHIVSQFQKPHLKRSRLIGDIRXAICXIKKHRXCHHGS 26 GSLGHHHHHHRL MAKISRRYHTFRRVLFRKRQIGDIRNAICXVLHHAVXYXQSKNNCKSXVXGS 27 GSLGHHHHHHRL MAFRLSYHNSFNGPVHRPHVFVHNXYRKGLRIGDIRFAPCXTHHLNSWSHGS 28 GSLGHHHHHHRL MAHWHRHHGHXIHYPYRFINLLFSPHXLDWIGDIRKANCXWFLYSVAXIGS 29 GSLGHHHHHHRL MAHFDPYCRLYVPAYNSHTIYYHQKTAYYYLFIGDIRIDAVAENRSPYPLRG 30 SGHHHHHHRLMAFDHHHXLIGDIRNDHNDFYHVEDGFANVYI ILYI IYSQTTSEVLIVSVGS 31 GSLGHHHHHHRL MAIXFAPRHIGDIRHPKQRTAHWKIKTAYPLKSLWKIRYRLKHIDRI FLSGS 32 GSLGHHHHHHRL MANXTLLQLKALRXSLSPLFLRLPLKASHAS IGDIRIXKTRRGPSFIRWYGS 33 GSLGHHHHHHRL MAKFAICHTIGDIRFEFTI IYTPHKYLVXDHDRHVXSLSVXLXSLXNHSRGS 34 GSLGHHHHHHRL MAKLKDKLNNXKXNTTNASAIGDIRIHANXLDVFLRNXHHKXTNYGRFLXGS 35 GSLGHHHHHHRL XPHYYHYNTXHXYYRHXHHS IGDIRSHFXPTKHIWLSGXLXLIHYKSSNNGS 36 GSLGHHHHHHRL MAHYTNNTLRPLARHHHFRLEQRFGRHLTSNIGDIRLNHVFHXXLRRYYVGS 37 GSLGHHHHHHRL MAKFHDKNSYKSKHKKYNXLIGDIRXFNSYHRXXNCNKLCHPXISWDLFIGS 38 GSLGHHHHHHRL MAYTEKHNGIGDIRPAICXNSKNQNHRCNHYQIKLYIHXLXRLPHNYR 39 NSGSGSGLGHHHHHHRL MALTLRYLKI GDIRLANCXTVFPHFLSKKFFENGHRNLARPCT FRRNR 40 HLGSGSGLGHHHHHHRL MAYHKHRVXHHHEDKATSLTSNLVRLRLKTRIGDIRRALCXLSKFRYL 41 INGSGSGLGHHHHHHRL MALLHHLRXIGDIRPAHCXVSHQRRYVP I SRKNVFFKRGFNSHPLRKI 42 LWGSGSGLGHHHHHHRL MARFRHSNNYYLTPFLTPLKTLI SLQLRYRLIGDIRNASYXHKFSNRN 43 RFGSGSGLGHHHHHHRL MAI FNQGYRIKAWNDLKDIAIGDIRHALCXLVLARIKLQRRXVKYKHD 44 HRGSGSGLGHHHHHHRL MAHQHHHPNYALXQRRLS IAIGDIRLAI CXFAHLYHCYRKHLXANT I P 45 XKGSGSGLGHHHHHHRL MAFVTYQHXSQKNFRRYQILRNHFHPQNYRFIGDIRHALCXFI FKNLX 46 RHGSGSGLGHHHHHHRL MAAXKIRSKIGDIRTAVCXFXHRHHHHHILDPYYLKXIVXYYSLKSRI 47 TLGSGSGLGHHHHHHRL MAFIKPCXXYLLPPTXLNLYIGDIRRAKCXEAXNNFHXNNKPLXATXP 48 PHGSGSGLGHHHHHHRL MAKDILKLRIPFATLSGHRNIGDIRHAYCXSLKRPYIQVYSYLNHLKV 49 RFGSGSGLGHHHHHHRL MATLHNIHDLNHYYRNLNTRI GDIRHATCXYFFXKLKLLKHNRFXDRA 50 IYGSGSGLGHHHHHHRL MAPYRINQQXNFPWS SALFQIGDIRHARCXDSCRRFTNIXRYVYLKRR 51 XNGSGSGLGHHHHHHRL MALFKPYPKI GDIRKARCXLQHTLHHRTNKQPSYRRRLKTL I PLFRRC 52 XLGSGSGLGHHHHHHRL MATNHLHRT I GDIRHAQCX IYL IYLVQNDQYKRNNRT FRLXLNPKLLK 53 RFGSGSGLGHHHHHHRL MATNSYYHHNPLXRRTHVVXTLKPXNFWAKXIGDIRRAHCXTT INXLK 54 RRGSGSGLGHHHHHHRL MAILLHVS TRSRYPHHHXAI IGDIRCASCXYPVLKWFYNFNRLKTYRK 55 QFGSGSGLGHHHHHHRL MAYRTHKLLHHHNDKWKSNI FPRI FVCHYYL I GDIRHARCX I PLE I LR 56 RYGSGSGLGHHHHHHRLMAYSKHRFS FRHNNXLRDRKL IRKFSYHNHS I GDIRVANKFRYLHVFK 57 FI GSGSGLGHHHHHHRL MAS IKLINQXXTTNPHLRLHIGDIRRLIKDLYXFRVYYRPTNSGRRLF 58 VNGSGSGLGHHHHHHRL MAHSHHHS PX IE FHSNGRLHI GDIRKFYADALXVLFFKXAFI DRI PFH 59 DAGSGSGLGHHHHHHRL MANI YFCSRRTNFHNSCYLXIGDIRGLS I YHHIXIHNKLHLLIXYNLL 60 XXGSGSGLGHHHHHHRL MAIHYHHP I IGDIRLKHNXINAHTKHVPQKLYLDIKFRRLFGLYI LRX 61 LNGSGSGLGHHHHHHRL MAI LYHYHNI GDIRRSQRHLNXQXRLYVS TLLHS SHTLRRAS I THRIR 62 KFGSGSGLGHHHHHHRL MAT FSRYHT I GDIRHHTLKHHQSKGLQXRL I FLKRQFKAXGNCLRWKI 63 LFGSGSGLGHHHHHHRL MAKYTHIHS IGDIRNTYRNKHKHXALNKTNWALFQQHHRXLIRLFYRR 64 LLGSGSGLGHHHHHHRL MALNKHKHLRNHTRHHSVPT I GDIRKRI HNLLHYLAGFRFFNQXHSKX 65 GVGSGSGLGHHHHHHRL MAYLHNHHNYSSNNKLHHLEIGDIRLI YQKYLRNPXFXTFLSRKHXNW 66 QRGSGSGLGHHHHHHRL MANLTAXSRI GDIRKHHFGRPLYLTKHGAYPRYHTRYKHLLTYRHHFP 67 L I GSGSGLGHHHHHHRL MAKHTHLRPXNFTQRLRKAHIGDIRLPRNI STSRIRTHIKFHLIRXHL 68 RNGSGSGLGHHHHHHRL MAFLLNHKRI GDIRKLPPLNLXATKTLTKERIRKIVNGFVQRLKGHSW 69 W I GSGSGLGHHHHHHRL MAIHHSYRGFTLRI PLTTNKIGDIRTAFPYPXLSHLFDRRRWKRGLHN 70 WFGSGSGLGHHHHHHRL_ wherein X is the modified amino acid residue to which the oligosaccharide is linked. 19. The glycopeptide according to claim 17, wherein said glycopeptide comprises the sequence: Sequence SEQ ID _ NO: MAYFVHKKSRLLTNKAVKKRLHGCFQNQRSTIGDIRYAKCXRVSSNFFRRGSV 71 MASHINSNPNQLLLLYLKSTIGDIRCAXCXDFRHYRNTKYVFXTRHNRRTGY 72 MASYYIHDIAVSAYSKRRGYHNIQVESLYPKIGDIRSAKCXTWRNHRHTX 73 MAHYSXNHXRHPLYPSVNHRXSYPRIGLLSRIGDIRSASCXLRCFRXRST 74 MAHNLRTXRNKNLIXLAFLHAPILKSRRLVHIGDIRVAACTHXVDVAPXY 75 XYPNTLNNVYQKCNKYNVIGDIRXARCXHXEHFSSQDQPKSKHKRRYKGF 76 MALIHSRQLVYSKNYXCCLDIGDIRHVLRGKYNDHLFGNAIYRKGVKAFN 77 MADNEFKILXIAXLHKSKHRTYLDYLNLVWXIGDIRAFQXXLKTVLXEAK 78 MAFHHXPHFTXRLPLLRRNCIGDIRRLYSPLPRDPHANFKFSFVEPNANR 79 MATDHNHSHRRPRREHLDXNXHYSRPXVANXIGDIRTFRRRYIQVXYHLXGSD 80 MAHXS I PHHRKS IDDSLRHLIGDIRYRNRYLXRILYRTSHYKNYYCQHS I 81 MANLXXYKXWNXTLFQWXATHRYSHFHNKCIGDIRTTXSWTRSXXXHAX 82 MATFSRYHT IGDIRHHTLKHHQSKGLQXRLI FLKRQFKAXGNCLRWKILFGSC 83 MALNSNSCHXRVATPISSWKIGDIRARFVSYLHYTNFSFSXXKXKFFTKX 84 MANVFPQTDRSLERSQCLFEAFHS IVXHXES IGDIRLECLRITIVALRTT 85MAIPNGYRAFNRADXLLLTRIGDIRNAHCXARCNYIYELRPLHHYRWSNR 86 MANTFSYHQKLKXGRHTDEILHTHXXHKKXXIGDIRYATCXKCVIKSHFX 87 MAIHKHLHIHNKKFSTFKSI IGDIRLAWCXNEYNIXPRCNSPRRFSYTAF 88 MAFKTNHTRCDHNSQHIVSQFQKPHLKRSRLIGDIRXAICXIKKHRXCHH 89 MAKISRRYHTFRRVLFRKRQIGDIRNAICXVLHHAVXYXQSKNNCKSXVX 90 MAFRLSYHNSFNGPVHRPHVFVHNXYRKGLRIGDIRFAPCXTHHLNSWSH 91 MAHWHRHHGHXIHYPYRFINLLFSPHXLDWIGDIRKANCXWFLYSVAXI 92 MAHFDPYCRLYVPAYNSHTIYYHQKTAYYYLFIGDIRIDAVAENRSPYPLRGS 93 MAFDHHHXLIGDIRNDHNDFYHVEDGFANVYI ILYI IYSQTTSEVLIVSV 94 MAIXFAPRHIGDIRHPKQRTAHWKIKTAYPLKSLWKIRYRLKHIDRIFLS 95 MANXTLLQLKALRXSLSPLFLRLPLKASHASIGDIRIXKTRRGPSFIRWY 96 MAKFAICHTIGDIRFEFTI IYTPHKYLVXDHDRHVXSLSVXLXSLXNHSR 97 MAKLKDKLNNXKXNTTNASAIGDIRIHANXLDVFLRNXHHKXTNYGRFLX 98 XPHYYHYNTXHXYYRHXHHSIGDIRSHFXPTKHIWLSGXLXLIHYKSSNN 99 MAHYTNNTLRPLARHHHFRLEQRFGRHLTSNIGDIRLNHVFHXXLRRYYV 100 MAKFHDKNSYKSKHKKYNXLIGDIRXFNSYHRXXNCNKLCHPXISWDLFI 101 MAYTEKHNGIGDIRPAICXNSKNQNHRCNHYQIKLYIHXLXRLPHNYRNS 102 MALTLRYLKIGDIRLANCXTVFPHFLSKKFFENGHRNLARPCT FRRNRHL 103 MAYHKHRVXHHHEDKATSLTSNLVRLRLKTRIGDIRRALCXLSKFRYLIN 104 MALLHHLRXIGDIRPAHCXVSHQRRYVPI SRKNVFFKRGFNSHPLRKILW 105 MARFRHSNNYYLTPFLTPLKTLI SLQLRYRLIGDIRNASYXHKFSNRNRF 106 MAI FNQGYRIKAWNDLKDIAIGDIRHALCXLVLARIKLQRRXVKYKHDHR 107 MAHQHHHPNYALXQRRLS IAIGDIRLAICXFAHLYHCYRKHLXANT I PXK 108 MAFVTYQHXSQKNFRRYQILRNHFHPQNYRFIGDIRHALCXFI FKNLXRH 109 MAAXKIRSKIGDIRTAVCXFXHRHHHHHILDPYYLKXIVXYYSLKSRITL 110 MAFIKPCXXYLLPPTXLNLYIGDIRRAKCXEAXNNFHXNNKPLXATXPPH 111 MAKDILKLRIPFATLSGHRNIGDIRHAYCXSLKRPYIQVYSYLNHLKVRF 112 MATLHNIHDLNHYYRNLNTRIGDIRHATCXYFFXKLKLLKHNRFXDRAIY 113 MAPYRINQQXNFPWSSALFQIGDIRHARCXDSCRRFTNIXRYVYLKRRXN 114 MALFKPYPKIGDIRKARCXLQHTLHHRTNKQPSYRRRLKTLI PLFRRCXL 115 MATNHLHRT IGDIRHAQCXIYLIYLVQNDQYKRNNRTFRLXLNPKLLKRF 116 MATNSYYHHNPLXRRTHVVXTLKPXNFWAKXIGDIRRAHCXTT INXLKRR 117 MAILLHVSTRSRYPHHHXAI IGDIRCASCXYPVLKWFYNFNRLKTYRKQF 118 MAYRTHKLLHHHNDKWKSNI FPRI FVCHYYLIGDIRHARCXI PLE ILRRY 119 MAYSKHRFS FRHNNXLRDRKLIRKFSYHNHS IGDIRVANKFRYLHVFKFI 120 MAS IKLINQXXTTNPHLRLHIGDIRRLIKDLYXFRVYYRPTNSGRRLFVN 121 MAHSHHHSPXIEFHSNGRLHIGDIRKFYADALXVLFFKXAFIDRIPFHDA 122 MANIYFCSRRTNFHNSCYLXIGDIRGLS IYHHIXIHNKLHLLIXYNLLXX 123 MAIHYHHPI IGDIRLKHNXINAHTKHVPQKLYLDIKFRRLFGLYILRXLN 124 MAILYHYHNIGDIRRSQRHLNXQXRLYVSTLLHSSHTLRRAS I THRIRKF 125 MATFSRYHT IGDIRHHTLKHHQSKGLQXRL I FLKRQFKAXGNCLRWKILF 126 MAKYTHIHS IGDIRNTYRNKHKHXALNKTNWALFQQHHRXLIRLFYRRLL 127 MALNKHKHLRNHTRHHSVPT IGDIRKRIHNLLHYLAGFRFFNQXHSKXGV 128 MAYLHNHHNYSSNNKLHHLE IGDIRLIYQKYLRNPXFXTFLSRKHXNWQR 129 MANLTAXSRIGDIRKHHFGRPLYLTKHGAYPRYHTRYKHLLTYRHHFPLI 130 MAKHTHLRPXNFTQRLRKAHIGDIRLPRNI STSRIRTHIKFHL IRXHLRN 131 MAFLLNHKRIGDIRKLPPLNLXATKTLTKERIRKIVNGFVQRLKGHSWWI 132 MAIHHSYRGFTLRI PLTTNKIGDIRTAFPYPXLSHLFDRRRWKRGLHNWF 133 wherein X is the modified amino acid residue to which the oligosaccharide is linked. 20. The glycopeptide according to claim 1, wherein the glycopeptide comprises a modified amino acid residue to which the oligosaccharide is linked. 21. The glycopeptide according to claim 20, wherein the glycopeptide comprises the sequence: Sequence _ SEQ ID NO: MAYFQNTSINNINALNQATQKNFFRIRLEIXTLNLVSKRYCNAXXHLLXXGFGS 134 LGHHHHHHRL MARFHSRSPFKDSHLFRNGTVGDIRSRAVHAQAEQRRGYLLVRLRGHRVGGLGS 135 LGHHHHHHRL MAKLKVCNXYAFSRPGWXIRKDIEFYYRINLVGDVRYATCXRYGYLILTQGSGS 136 LGHHHHHHRL MATYHXTINXNXAYRXRTYSARNSIVSTENHIDDIRAAQCXTNPKHLSFIGSGT 137 LGHHHHHHRL MANHKHTHISLKSIVQTHGGPHPNVARAANLLLEQLPVVRRRLQRRLLQRGLRS 138 LGHHHHHHRL XSNYVNSYLNTHLQLDQSTTIGDIHGLRKLGRYATESSFXRIHNISFLSHGSGS 139 LGHHHHHHRL MAIRKNFPXTFGHRPHLRVAHAQRAQHALLVLRRARRLLDQEVDAPGGRRG 140 SGSGLGHHHHHHRL MAHHYPNYHXRSHGDRLTLLRHLXS FLVDHKQILXFLLRXRKNHVSXXXTG 141 SGSGLGHHHHHHRL wherein X is the modified amino acid residue to which the oligosaccharide is linked. 22. The glycopeptide according to claim 20, wherein the glycopeptide comprises the sequence: Sequence SEQ ID _ NO: MAYFQNTSINNINALNQATQKNFFRIRLEIXTLNLVSKRYCNAXXHLLXXGF 142 MARFHSRSPFKDSHLFRNGTVGDIRSRAVHAQAEQRRGYLLVRLRGHRVGGL 143 MAKLKVCNXYAFSRPGWXIRKDIEFYYRINLVGDVRYATCXRYGYLILTQ 144 MATYHXTINXNXAYRXRTYSARNSIVSTENHIDDIRAAQCXTNPKHLSFIGSGT 145 MANHKHTHISLKSIVQTHGGPHPNVARAANLLLEQLPWRRRLQRRLLQRGLR 146 XSNYVNSYLNTHLQLDQSTTIGDIHGLRKLGRYATESSFXRIHNISFLSH 147 MAIRKNFPXTFGHRPHLRVAHAQRAQHALLVLRRARRLLDQEVDAPGGRR 148 MAHHYPNYHXRSHGDRLTLLRHLXS FLVDHKQILXFLLRXRKNHVSXXXT 149 wherein X is the modified amino acid residue to which the oligosaccharide is linked. 23. The glycopeptide according to claim 1, wherein the glycopeptide is a cyclic glycopeptide. 24. The glycopeptide according to claim 23, wherein the glycopeptide comprises the sequence: SEQ ID Sequence _ NO: |- linker - 1 8 MAYFVHKKSRLLTNKAVKKRLHGCFQNQRSTIGDIRYAKCXRVSSNFFRRGSVSL GHHHHHHRL [-linker—| 9 MASHINSNPNQLLLLYLKSTIGDIRCAX_ CXDFRHYRNTKYVFXTRHNRRT GYGSLGHHHHHHRL [Linker—| 11 MAHYSXNHXRHPLYPSVNHRXSYPRIGLLSRIGDIRSASCXLR_CFRXRSTG SGSLGHHHHHHRL I- Linker- 13 XYPNTLNNVYQKCNKYNVIGDIRXARCXHXEHFSSQDQPKSKHKRRYKGFGSLGH HHHHHRL |— linker-] 14 MALIHSRQLVYSKNYXC_ CLDIGDIRHVLRGKYNDHLFGNAIYRKGVKA FNGSGSLGHHHHHHRL I—linker- 20 MATFSRYHTIGDIRHHTLKHHQSKGLQXRLIFLKRQFKAXGNCLRWKILFGSCSL GHHHHHHRL I- linker- 22 MANVFPQTDRSLERSQCLFEAFHSIVXHXESIGDIRLECLRITIVALRTTGSGSL GHHHHHHRL [-linker-] 23 MAIPNGYRAFNRADXLLLTRIGDIRNAHCXAR_CNYIYELRPLHHYRWSNRGS GSLGHHHHHHRL |-linker-| 24 MANTFSYHQKLKXGRHTDEILHTHXXHKKXXIGDIRYATCXK_CVIKSHFXG SGSLGHHHHHHRL I—linker- 25 MAIHKHLHIHNKKFSTFKSI IGDIRLAWCXNEYNIXPRCNSPRRFSYTAFGSGSL GHHHHHHRL I- linker- 27 MAKISRRYHTFRRVLFRKRQIGDIRNAICXVLHHAVXYXQSKNNCKSXVXGSGSL GHHHHHHRL I- linker- 136 MAKLKVCNXYAFSRPGWXIRKDIEFYYRINLVGDVRYATCXRYGYLILTQGSGSL GHHHHHHRL [-linker-] 38 MAKFHDKNSYKSKHKKYNXLIGDIRXFNSYHRXXNCNKL_CHPXISWDLFIGS GSLGHHHHHHRL I- linker- 71 MAYFVHKKSRLLTNKAVKKRLHGCFQNQRSTIGDIRYAKCXRVSSNFFRRGSV [-linker-] 72 MASHINSNPNQLLLLYLKSTIGDIRCAX_CXDFRHYRNTKYVFXTRHNRRTG Y I—linker-] 74 MAHYSXNHXRHPLYPSVNHRXSYPRIGLLSRIGDIRSASCXLR CFRXRSTI--linker-1 76 XYPNTLNNVYQKCNKYNVIGDIRXARCXHXEHFSSQDQPKSKHKRRYKGF |—linker-) 77 MALIHSRQLVYSKNYXC_ CLDIGDIRHVLRGKYNDHLFGNAIYRKGVKA FN I-linker—| 83 MATFSRYHTIGDIRHHTLKHHQSKGLQXRLIFLKRQFKAXGNCLRWKILFGSC I- linker- 1 85 MANVFPQTDRSLERSQCLFEAFHSIVXHXESIGDIRLECLRITIVALRTT [-linker-) 86 MAIPNGYRAFNRADXLLLTRIGDIRNAHCXAR CNYIYELRPLHHYRWSNR linker-| 87 XK_CVIKSHFX88 MAIHKHLHIHNKKFSTFKSIIGDIRLAWCXNEYNIXPRCNSPRRFSYTAF I- linker- 1 90 MAKISRRYHTFRRVLFRKRQIGDIRNAICXVLHHAVXYXQSKNNCKSXVX (-linker-) 101 MAKFHDKNSYKSKHKKYNXLIGDIRXFNSYHRXXNCNKL_CHPXISWDLFI I- linker- 1 144 MAKLKVCNXYAFSRPGWXIRKDIEFYYRINLVGDVRYATCXRYGYLILTQ I—linker-1 39 MAYTEKHNGIGDIRPAICXNSKNQNHRCNHYQIKLYIHXLXRLPHNYRNSGSGSG LGHHHHHHRL I—linker- 1 40 MALTLRYLKIGDIRLANCXTVFPHFLSKKFFENGHRNLARPCTFRRNRHLGSGSG LGHHHHHHRL [-linker—| 45 MAHQHHHPNYALXQRRLSIAIGDIRLAICXFAHLYHCYRKHLXANTIPXKGSGSG LGHHHHHHRL I- -linker- 1 48 MAFIKPCXXYLLPPTXLNLYIGDIRRAKCXEAXNNFHXNNKPLXATXPPHGSGSG LGHHHHHHRL [—linker—| 51 MAPYRINQQXNFPWSSALFQIGDIRHARCXDS_ CRRFTNIXRYVYLKRRXN GSGSGLGHHHHHHRL I- linker- 1 52 MALFKPYPKIGDIRKARCXLQHTLHHRTNKQPSYRRRLKTLIPLFRRCXLGSGSG LGHHHHHHRL I—linker—| 55 MAILLHVSTRSRYPHHHXAI IGDIRCAS_ CXYPVLKWFYNFNRLKTYRKQ FGSGSGLGHHHHHHRL |— linker- 1 56 MAYRTHKLLHHHNDKWKSNIFPRIFVCHYYLIGDIRHARCXIPLEILRRYGSGSG LGHHHHHHRL [—linker—| 60 MANIYFCSRRTNFHNSCYLXIGDIRGLSIYHHIXIHNKLHLLIXYNLLXXGSGSG LGHHHHHHRL [—linker-1 102 MAYTEKHNGIGDIRPAICXNSKNQNHRCNHYQIKLYIHXLXRLPHNYRNS |— linker- 1 103 MALTLRYLKIGDIRLANCXTVFPHFLSKKFFENGHRNLARPCTFRRNRHLI—linker-] 108 MAHQHHHPNYALXQRRLSIAIGDIRLAICXFAHLYHCYRKHLXANTIPXK I-linker- 111 MAFIKPCXXYLLPPTXLNLYIGDIRRAKCXEAXNNFHXNNKPLXATXPPH I—linker—| 114 MAPYRINQQXNFPWSSALFQIGDIRHARCXDS_ CRRFTNIXRYVYLKRRX N [—linker- 115 MALFKPYPKIGDIRKARCXLQHTLHHRTNKQPSYRRRLKTLIPLFRRCXL [—linker—| 118 MAILLHVSTRSRYPHHHXAI IGDIRCAS_ CXYPVLKWFYNFNRLKTYRKQ F I—linker- 119 MAYRTHKLLHHHNDKWKSNIFPRIFVCHYYLIGDIRHARCXIPLEILRRY I—linker- 123 MANIYFCSRRTNFHNSCYLXIGDIRGLSIYHHIXIHNKLHLLIXYNLLXX wherein X is the modified amino acid residue to which the oligosaccharide is linked, and the Cys-Cys linker is a bis-alkylbenzene group or bis-alkylpyridine group. 25. The glycopeptide according to any one of claims 1 to 13, wherein the glycopeptide binds specifically to monoclonal antibody PGT130 with an affinity of less than 50 nM. 26. The glycopeptide according to any one of claims 1 to 13, wherein the glycopeptide binds specifically to monoclonal antibody PGT130 with an affinity of less than 10 nM. 27. The glycopeptide according to claim 1, wherein the monoclonal antibody PGT130 binds specifically to Man9GlcNAc2 glycans on HIV gpl20 with an affinity comparable to the affinity of PGT130 binding to said glycopeptide. 28. The glycopeptide according to claim 1, wherein the glycopeptide binds specifically to PGT130 and comprises the sequence IGDIR (SEQ ID NO: 1) or IGDIRxA (SEQ ID NO:2), and a modified amino acid residue to which the oligosaccharide is linked. 29. The glycopeptide according to claim 28, wherein said glycopeptide comprises the sequence: Sequence _ SEQ ID NO: MANHSHGHNIGDIRDATCXLSNCYHYNNRRKNRFTLFTLLRILVQKSLFRGSGS 150 GLGHHHHHHRL MAI FNQGYRIKAWNDLKDIAIGDIRHALCXLVLARIKLQRRXVKYKHDHRGSGS 151 GLGHHHHHHRL MAIHHTHLNIGDIRFRHFPRRYRNNWXNFLFLVLRALTWKNRLAFFSNDHGSGS 152 GLGHHHHHHRL MAINXS IRLIGDIRPAQAQRGHLAPHARRVRHEVLGLVLERLLVLRRLVRGSGS 153 GLGHHHHHHRL MAFLLNHKRIGDIRKLPPLNLXATKTLTKERIRKIVNGFVQRLKGHSWWIGSGS 154 GLGHHHHHHRL wherein X is the modified amino acid residue to which the oligosaccharide is linked. 30. The glycopeptide according to claim 28, wherein said glycopeptide comprises the sequence: Sequence _ SEQ ID NO: MANHSHGHNIGDIRDATCXLSNCYHYNNRRKNRFTLFTLLRILVQKSLFR 155 MAI FNQGYRIKAWNDLKDIAIGDIRHALCXLVLARIKLQRRXVKYKHDHR 156 MAIHHTHLNIGDIRFRHFPRRYRNNWXNFLFLVLRALTWKNRLAFFSNDH 157 MAINXS IRLIGDIRPAQAQRGHLAPHARRVRHEVLGLVLERLLVLRRLVR 158 MAFLLNHKRIGDIRKLPPLNLXATKTLTKERIRKIVNGFVQRLKGHSWWI 159 wherein X is the modified amino acid residue to which the oligosaccharide is linked. 31. The glycopeptide according to claim 1, wherein the glycopeptide comprises a modified amino acid residue to which the oligosaccharide is linked. 32. The glycopeptide according to claim 31, wherein the glycopeptide comprises the sequence: uence SEQ ID NO: MAYKKTFXDIGDSYGELHAQARRREAVRRLLRLVRHRVLLHLLRAVLHAR 160 GSGSGLGHHHHHHRL MASSFRLHNXGPSRXRHWDRLLTIYS IGVSTLANSLRVLHGVAHRGRHLG 161 GSGSGLGHHHHHHRL MAYYNHPKLRQYLVKXLTRLRRYSYRELHDGDDHARQAHRGRLLQDLVDR GSGSGLGHHHHHHRL 162 MAYDPLHKASHSNHPQPYRYIGVIRHPLXRQS ISQI FKILLIRYLRKHRR 163 GSGSGLGHHHHHHRL wherein X is the modified amino acid residue to which the oligosaccharide is linked. 33. The glycopeptide according to claim 31, wherein the glycopeptide comprises the sequence: Sequence _ SEQ ID NO: MAYKKTFXDIGDSYGELHAQARRREAVRRLLRLVRHRVLLHLLRAVLHAR 164 MASSFRLHNXGPSRXRHWDRLLTIYSIGVSTLANSLRVLHGVAHRGRHLG 165 MAYYNHPKLRQYLVKXLTRLRRYSYRELHDGDDHARQAHRGRLLQDLVDR 166 MAYDPLHKASHSNHPQPYRYIGVIRHPLXRQSISQIFKILLIRYLRKHRR 167 wherein X is the modified amino acid residue to which the oligosaccharide is linked. 34. The glycopeptide according to claim 23, wherein the glycopeptide comprises the sequence: Sequence SEQ ID NO: linker· 150 MANHSHGHNIGDIRDATCXLSN_CYHYNNRRKNRFTLFTLLRILVQKSLFR GSGSGLGHHHHHHRL |-linker-| 155 MANHSHGHNIGDIRDATCXLSN CYHYNNRRKNRFTLFTLLRILVQKSLFR wherein X is the modified amino acid residue to which the oligosaccharide is linked, and the Cys-Cys linker is a bis-alkylbenzene group or bis-alkylpyridine group. 35. The glycopeptide according to claim 23, wherein the cyclic glycopeptide comprises a linker molecule between two cysteine sidechains. 36. The glycopeptide according to claim 35, wherein the linker molecule comprises (i) -C(0)0-(CH2)n-CH3, where n is 0 to 6 or (ii) an immunogenic carrier molecule. 37. An immunogenic conjugate comprising a glycopeptide according to one of claims 1 to 26 covalently or non-covalently bound to an immunogenic carrier molecule. 38. The immunogenic conjugate according to claim 37, wherein the immunogenic carrier molecule is selected from the group consisting of bovine serum albumin, chicken egg ovalbumin, keyhole limpet hemocyanin, tetanus toxoid, diphtheria toxoid, thyroglobulin, a pneumococcal capsular polysaccharide, CRM 197, and a meningococcal outer membrane protein. 39. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and a glycopeptide according to one of claims 1 to 36 or an immunogenic conjugate according to claim 37 or 38. 40. The pharmaceutical composition according to claim 39, wherein the glycopeptide is present. 41. The pharmaceutical composition according to claim 39, wherein the immunogenic conjugate is present. 42. The pharmaceutical composition according to claim 39, further comprising an adjuvant. 43. The pharmaceutical composition according to claim 42, wherein the adjuvant comprises aluminum hydroxide, aluminum phosphate, aluminum potassium sulfate, beryllium sulfate, silica, kaolin, carbon, water-in-oil emulsions, oil-in-water emulsions, muramyl dipeptide, bacterial endotoxin, lipid, Quil A, non-infective Bor detella pertussis, QS-21, monophosphoryl lipid A, an alpha-galactosylceramide derivative, or PamCys-type lipids. 44. The pharmaceutical composition according to one of claims 39 to 43 wherein the pharmaceutically acceptable carrier is a buffered saline solution. 45. The pharmaceutical composition according to one of claims 39 to 43, further comprising one or more additives or preservatives, or both. 46. The pharmaceutical composition according to one of claims 39 to 43, wherein the composition is present as a single dosage unit comprising about 1 pg to about 5 mg of the glycopeptide. 47. A method of inducing an immune response in an individual comprising: administering to an individual a glycopeptide according to one of claims 1 to 36, an immunogenic conjugate according to claim 37 or 38, or a pharmaceutical composition according to one of claims 39 to 46, wherein said administering is effective to induce an immune response against the glycopeptide. 48. A method of inhibiting viral infection comprising: administering to an individual an glycopeptide according to one of claims 1 to 36, an immunogenic conjugate according to claim 37 or 38, or a pharmaceutical composition according to one of claims 29 to 36, wherein said administering is effective to induce a neutralizing immune response against a virus pathogen. 49. A method for detecting a neutralizing antibody in serum comprising: providing a glycopeptide according to any one of claims 1 to 36; contacting the glycopeptide with serum from an individual; and detecting whether the glycopeptide binds specifically to an antibody present in the serum, wherein said detecting is carried out using a label. 50. A method of preparing glycopeptides comprising: providing an mRNA-displayed polypeptide having an N-terminal homopropargylglycine or allylglycine residue; treating the mRNA-displayed polypeptide with an enzyme suitable to remove the N- terminal homopropargylglycine or allylglycine residue from the polypeptide; and reacting the mRNA-displayed polypeptide recovered from said treating step with an oligosaccharide linked to a reactive moiety that is capable of reacting with a sidechain of one or more modified amino acids present in the polypeptide to thereby form a glycopeptide comprising one or more oligosaccharides linked to amino acid sidechains. 51. The method according to claim 50, wherein the N-terminal homopropargylglycine or allylglycine residue is formylated, and the enzyme is a first treatment with peptide deformylase and a second treatment with methionine aminopeptidase. 52. The method according to claim 50, wherein the peptide includes an enterokinase cleavage sequence located within 1-10 residues of the N-terminus, and the enzyme is an enterokinase suitable to cleave the cleavage sequence.
最新评论
暂无评论。